Placeholder image of a protein
Icon representing a puzzle

1819: Revisiting Puzzle 110: Turkey

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Herobrine's Army
    1. Herobrine's Army
    100 pts. 10,578
  2. Avatar for Contenders 2. Contenders 83 pts. 10,571
  3. Avatar for Go Science 3. Go Science 68 pts. 10,555
  4. Avatar for Beta Folders 4. Beta Folders 55 pts. 10,496
  5. Avatar for HMT heritage 5. HMT heritage 44 pts. 10,395
  6. Avatar for Void Crushers 6. Void Crushers 35 pts. 10,386
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 27 pts. 10,361
  8. Avatar for Gargleblasters 8. Gargleblasters 21 pts. 10,334
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 16 pts. 10,305
  10. Avatar for Team India 10. Team India 12 pts. 10,227
  1. Avatar for wosser1 81. wosser1 Lv 1 28 pts. 9,787
  2. Avatar for yunifay 82. yunifay Lv 1 28 pts. 9,786
  3. Avatar for OWM3 83. OWM3 Lv 1 27 pts. 9,785
  4. Avatar for fisherlr777 84. fisherlr777 Lv 1 27 pts. 9,783
  5. Avatar for hada 85. hada Lv 1 26 pts. 9,783
  6. Avatar for georg137 86. georg137 Lv 1 26 pts. 9,778
  7. Avatar for not_publius 87. not_publius Lv 1 25 pts. 9,757
  8. Avatar for meatexplosion 88. meatexplosion Lv 1 25 pts. 9,755
  9. Avatar for dahast.de 89. dahast.de Lv 1 24 pts. 9,740
  10. Avatar for kubek915 90. kubek915 Lv 1 24 pts. 9,739

Comments

O Seki To Lv 1

Shouldn't the coronavirus puzzles be changed to all hands, as I suggested a week ago?
This one is quite meaningless, no reason for a joint effort to solve it.
Unless this is the cure for COVID-19…