Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 18 pts. 9,477
  2. Avatar for BOINC@Poland 12. BOINC@Poland 15 pts. 9,335
  3. Avatar for foldeRNA 13. foldeRNA 12 pts. 9,258
  4. Avatar for HMT heritage 14. HMT heritage 9 pts. 9,059
  5. Avatar for SETI.Germany 15. SETI.Germany 8 pts. 8,923
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 6 pts. 8,689
  7. Avatar for Penny-Arcade 17. Penny-Arcade 5 pts. 8,645
  8. Avatar for Deleted group 18. Deleted group pts. 8,456
  9. Avatar for Australia 19. Australia 3 pts. 8,194
  10. Avatar for Mojo Risin' 20. Mojo Risin' 2 pts. 7,596
  1. Avatar for Mel84 411. Mel84 Lv 1 1 pt. 4,432
  2. Avatar for Verevyta 412. Verevyta Lv 1 1 pt. 4,379
  3. Avatar for buckewale 413. buckewale Lv 1 1 pt. 4,279
  4. Avatar for villar3 414. villar3 Lv 1 1 pt. 4,278
  5. Avatar for darkkobold 415. darkkobold Lv 1 1 pt. 4,246
  6. Avatar for hereismystupidusername 416. hereismystupidusername Lv 1 1 pt. 4,185
  7. Avatar for Honor 417. Honor Lv 1 1 pt. 4,111
  8. Avatar for lilbody 418. lilbody Lv 1 1 pt. 4,104
  9. Avatar for LuciferAgenda 419. LuciferAgenda Lv 1 1 pt. 4,058
  10. Avatar for hada 420. hada Lv 1 1 pt. 3,977

Comments

Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.