Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 18 pts. 9,477
  2. Avatar for BOINC@Poland 12. BOINC@Poland 15 pts. 9,335
  3. Avatar for foldeRNA 13. foldeRNA 12 pts. 9,258
  4. Avatar for HMT heritage 14. HMT heritage 9 pts. 9,059
  5. Avatar for SETI.Germany 15. SETI.Germany 8 pts. 8,923
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 6 pts. 8,689
  7. Avatar for Penny-Arcade 17. Penny-Arcade 5 pts. 8,645
  8. Avatar for Deleted group 18. Deleted group pts. 8,456
  9. Avatar for Australia 19. Australia 3 pts. 8,194
  10. Avatar for Mojo Risin' 20. Mojo Risin' 2 pts. 7,596

  1. Avatar for Utsav_Mak 532. Utsav_Mak Lv 1 1 pt. 0
  2. Avatar for netkuba 533. netkuba Lv 1 1 pt. 0
  3. Avatar for ingoneato 534. ingoneato Lv 1 1 pt. 0
  4. Avatar for apmarsenault 535. apmarsenault Lv 1 1 pt. 0
  5. Avatar for smhrofl 536. smhrofl Lv 1 1 pt. 0
  6. Avatar for Alan33 537. Alan33 Lv 1 1 pt. 0
  7. Avatar for ZoomZoom 538. ZoomZoom Lv 1 1 pt. 0
  8. Avatar for endyzz 539. endyzz Lv 1 1 pt. 0
  9. Avatar for Antsworld 540. Antsworld Lv 1 1 pt. 0

Comments


Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.