1820: Coronavirus ORF8 Prediction
Closed since about 6 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- April 01, 2020
- Expires
- Max points
- 100
Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!
Sequence:
MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Top groups
Comments
aofreelancer Lv 1
I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.