Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups


  1. Avatar for Minions of TWIS 21. Minions of TWIS 2 pts. 7,427
  2. Avatar for Deleted group 22. Deleted group pts. 7,375
  3. Avatar for Italiani Al Lavoro 23. Italiani Al Lavoro 1 pt. 7,074
  4. Avatar for UC Davis 24. UC Davis 1 pt. 5,678
  5. Avatar for CHNO Junkies 25. CHNO Junkies 1 pt. 4,823
  6. Avatar for Trinity Biology 27. Trinity Biology 1 pt. 4,577
  7. Avatar for Coastal Biochemistry 28. Coastal Biochemistry 1 pt. 4,505
  8. Avatar for Team South Africa 29. Team South Africa 1 pt. 1,384
  9. Avatar for incognito group 30. incognito group 1 pt. 0

  1. Avatar for dlytle 261. dlytle Lv 1 7 pts. 7,517
  2. Avatar for haggisfam 262. haggisfam Lv 1 7 pts. 7,508
  3. Avatar for haabermaaster 263. haabermaaster Lv 1 7 pts. 7,506
  4. Avatar for jamesruskiewicz 264. jamesruskiewicz Lv 1 7 pts. 7,499
  5. Avatar for Philippe_C 265. Philippe_C Lv 1 7 pts. 7,488
  6. Avatar for clark92 266. clark92 Lv 1 7 pts. 7,462
  7. Avatar for Igoradrianobr 267. Igoradrianobr Lv 1 7 pts. 7,458
  8. Avatar for pascal ochem 268. pascal ochem Lv 1 7 pts. 7,457
  9. Avatar for marcolinguri 269. marcolinguri Lv 1 7 pts. 7,449
  10. Avatar for Mitcz 270. Mitcz Lv 1 7 pts. 7,434

Comments


Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.