Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups

  1. Avatar for Minions of TWIS 21. Minions of TWIS 2 pts. 7,427
  2. Avatar for Deleted group 22. Deleted group pts. 7,375
  3. Avatar for Italiani Al Lavoro 23. Italiani Al Lavoro 1 pt. 7,074
  4. Avatar for UC Davis 24. UC Davis 1 pt. 5,678
  5. Avatar for CHNO Junkies 25. CHNO Junkies 1 pt. 4,823
  6. Avatar for Richard Dawkins Foundation 26. Richard Dawkins Foundation 1 pt. 4,594
  7. Avatar for Trinity Biology 27. Trinity Biology 1 pt. 4,577
  8. Avatar for Coastal Biochemistry 28. Coastal Biochemistry 1 pt. 4,505
  9. Avatar for Team South Africa 29. Team South Africa 1 pt. 1,384
  10. Avatar for incognito group 30. incognito group 1 pt. 0
  1. Avatar for nicobul 21. nicobul Lv 1 86 pts. 10,196
  2. Avatar for fiendish_ghoul 22. fiendish_ghoul Lv 1 85 pts. 10,119
  3. Avatar for jobo0502 23. jobo0502 Lv 1 84 pts. 10,118
  4. Avatar for Ignacio 24. Ignacio Lv 1 84 pts. 10,082
  5. Avatar for drumpeter18yrs9yrs 25. drumpeter18yrs9yrs Lv 1 83 pts. 10,077
  6. Avatar for lynnai 26. lynnai Lv 1 82 pts. 10,071
  7. Avatar for spvincent 27. spvincent Lv 1 81 pts. 10,069
  8. Avatar for spmm 28. spmm Lv 1 81 pts. 10,040
  9. Avatar for retiredmichael 29. retiredmichael Lv 1 80 pts. 10,037
  10. Avatar for phi16 30. phi16 Lv 1 80 pts. 10,030

Comments

Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.