Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups

  1. Avatar for Minions of TWIS 21. Minions of TWIS 2 pts. 7,427
  2. Avatar for Deleted group 22. Deleted group pts. 7,375
  3. Avatar for Italiani Al Lavoro 23. Italiani Al Lavoro 1 pt. 7,074
  4. Avatar for UC Davis 24. UC Davis 1 pt. 5,678
  5. Avatar for CHNO Junkies 25. CHNO Junkies 1 pt. 4,823
  6. Avatar for Richard Dawkins Foundation 26. Richard Dawkins Foundation 1 pt. 4,594
  7. Avatar for Trinity Biology 27. Trinity Biology 1 pt. 4,577
  8. Avatar for Coastal Biochemistry 28. Coastal Biochemistry 1 pt. 4,505
  9. Avatar for Team South Africa 29. Team South Africa 1 pt. 1,384
  10. Avatar for incognito group 30. incognito group 1 pt. 0
  1. Avatar for EvaStu 561. EvaStu Lv 1 1 pt. 0
  2. Avatar for RockOn 562. RockOn Lv 1 1 pt. 0
  3. Avatar for jop 563. jop Lv 1 1 pt. 0
  4. Avatar for Raybancris 564. Raybancris Lv 1 1 pt. 0
  5. Avatar for KevinE 565. KevinE Lv 1 1 pt. 0
  6. Avatar for Gyula85 566. Gyula85 Lv 1 1 pt. 0
  7. Avatar for sad_animus 567. sad_animus Lv 1 1 pt. 0
  8. Avatar for sarutake 568. sarutake Lv 1 1 pt. 0
  9. Avatar for vidaaaz 569. vidaaaz Lv 1 1 pt. 0
  10. Avatar for cannabisune 570. cannabisune Lv 1 1 pt. 0

Comments

Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.