Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups



  1. Avatar for jausmh 101. jausmh Lv 1 43 pts. 9,060
  2. Avatar for alcor29 102. alcor29 Lv 1 42 pts. 9,057
  3. Avatar for John McLeod 103. John McLeod Lv 1 42 pts. 9,055
  4. Avatar for Dudit 104. Dudit Lv 1 41 pts. 9,054
  5. Avatar for Vman 105. Vman Lv 1 41 pts. 9,051
  6. Avatar for O Seki To 106. O Seki To Lv 1 41 pts. 9,050
  7. Avatar for manu8170 107. manu8170 Lv 1 40 pts. 9,042
  8. Avatar for kathy65 108. kathy65 Lv 1 40 pts. 9,033
  9. Avatar for CAN1958 109. CAN1958 Lv 1 40 pts. 9,028
  10. Avatar for TastyMunchies 110. TastyMunchies Lv 1 39 pts. 9,019

Comments


Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.