Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups



  1. Avatar for johnmitch 111. johnmitch Lv 1 39 pts. 9,015
  2. Avatar for enntau 112. enntau Lv 1 38 pts. 8,960
  3. Avatar for diamonddays 113. diamonddays Lv 1 38 pts. 8,959
  4. Avatar for Czim 114. Czim Lv 1 38 pts. 8,940
  5. Avatar for YGK 115. YGK Lv 1 37 pts. 8,923
  6. Avatar for Schleicher 116. Schleicher Lv 1 37 pts. 8,923
  7. Avatar for momadoc 117. momadoc Lv 1 37 pts. 8,916
  8. Avatar for Crossed Sticks 118. Crossed Sticks Lv 1 36 pts. 8,909
  9. Avatar for Angelleo 119. Angelleo Lv 1 36 pts. 8,908
  10. Avatar for samchop 120. samchop Lv 1 36 pts. 8,894

Comments


Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.