Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups



  1. Avatar for infjamc 141. infjamc Lv 1 29 pts. 8,661
  2. Avatar for Tygh 142. Tygh Lv 1 29 pts. 8,647
  3. Avatar for LastAndroid 143. LastAndroid Lv 1 28 pts. 8,645
  4. Avatar for brow42 144. brow42 Lv 1 28 pts. 8,628
  5. Avatar for edpalas 145. edpalas Lv 1 28 pts. 8,607
  6. Avatar for Tommy Tsunami 146. Tommy Tsunami Lv 1 28 pts. 8,590
  7. Avatar for multaq 147. multaq Lv 1 27 pts. 8,589
  8. Avatar for MrZanav 148. MrZanav Lv 1 27 pts. 8,581
  9. Avatar for mathwins 149. mathwins Lv 1 27 pts. 8,543
  10. Avatar for p34t 150. p34t Lv 1 26 pts. 8,526

Comments


Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.