Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups



  1. Avatar for tangofox10 151. tangofox10 Lv 1 26 pts. 8,524
  2. Avatar for Karlheinz 152. Karlheinz Lv 1 26 pts. 8,517
  3. Avatar for Maraki 153. Maraki Lv 1 26 pts. 8,517
  4. Avatar for yaksari 154. yaksari Lv 1 25 pts. 8,504
  5. Avatar for peggyemmy 155. peggyemmy Lv 1 25 pts. 8,496
  6. Avatar for not_publius 156. not_publius Lv 1 25 pts. 8,488
  7. Avatar for georg137 157. georg137 Lv 1 25 pts. 8,473
  8. Avatar for Pazithi 158. Pazithi Lv 1 24 pts. 8,469
  9. Avatar for navn 159. navn Lv 1 24 pts. 8,465
  10. Avatar for 400134401 160. 400134401 Lv 1 24 pts. 8,456

Comments


Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.