Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups



  1. Avatar for TR77 171. TR77 Lv 1 21 pts. 8,309
  2. Avatar for Bigkam10 172. Bigkam10 Lv 1 21 pts. 8,304
  3. Avatar for paja22 173. paja22 Lv 1 21 pts. 8,294
  4. Avatar for Alistair69 174. Alistair69 Lv 1 21 pts. 8,284
  5. Avatar for Arne Heessels 175. Arne Heessels Lv 1 20 pts. 8,281
  6. Avatar for NeLikomSheet 176. NeLikomSheet Lv 1 20 pts. 8,271
  7. Avatar for wosser1 177. wosser1 Lv 1 20 pts. 8,268
  8. Avatar for Deleted player 178. Deleted player pts. 8,257
  9. Avatar for Dr_Fitch_mbs 179. Dr_Fitch_mbs Lv 1 20 pts. 8,255
  10. Avatar for Strawberry7 180. Strawberry7 Lv 1 19 pts. 8,241

Comments


Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.