Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups



  1. Avatar for Quantenkobold 181. Quantenkobold Lv 1 19 pts. 8,232
  2. Avatar for EmC_98 182. EmC_98 Lv 1 19 pts. 8,229
  3. Avatar for hotator 183. hotator Lv 1 19 pts. 8,218
  4. Avatar for Evica 184. Evica Lv 1 18 pts. 8,216
  5. Avatar for rabamino12358 185. rabamino12358 Lv 1 18 pts. 8,204
  6. Avatar for foldit109ljsd 186. foldit109ljsd Lv 1 18 pts. 8,195
  7. Avatar for ExcitableMonkey 187. ExcitableMonkey Lv 1 18 pts. 8,194
  8. Avatar for Feet1stEvolves 188. Feet1stEvolves Lv 1 18 pts. 8,185
  9. Avatar for dahast.de 189. dahast.de Lv 1 17 pts. 8,174
  10. Avatar for Black Dahlia 190. Black Dahlia Lv 1 17 pts. 8,166

Comments


Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.