Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups

  1. Avatar for Star Fleet Academy Sciences Division 31. Star Fleet Academy Sciences Division 1 pt. 0
  2. Avatar for SHELL 32. SHELL 1 pt. 0
  3. Avatar for Foldit_SaintJohn(NB) 33. Foldit_SaintJohn(NB) 1 pt. 0
  4. Avatar for Russian team 34. Russian team 1 pt. 0
  5. Avatar for Team India 35. Team India 1 pt. 0
  1. Avatar for ohbe1 231. ohbe1 Lv 1 11 pts. 7,875
  2. Avatar for grobi1971 232. grobi1971 Lv 1 11 pts. 7,867
  3. Avatar for Dantoto 233. Dantoto Lv 1 11 pts. 7,865
  4. Avatar for Altercomp 234. Altercomp Lv 1 10 pts. 7,863
  5. Avatar for EPBRZH 235. EPBRZH Lv 1 10 pts. 7,860
  6. Avatar for yippee 236. yippee Lv 1 10 pts. 7,855
  7. Avatar for sgfronz 237. sgfronz Lv 1 10 pts. 7,842
  8. Avatar for HeidieU 238. HeidieU Lv 1 10 pts. 7,835
  9. Avatar for DoomDog 239. DoomDog Lv 1 10 pts. 7,830
  10. Avatar for EmmaLives 240. EmmaLives Lv 1 10 pts. 7,825

Comments

Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.