Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups

  1. Avatar for Star Fleet Academy Sciences Division 31. Star Fleet Academy Sciences Division 1 pt. 0
  2. Avatar for SHELL 32. SHELL 1 pt. 0
  3. Avatar for Foldit_SaintJohn(NB) 33. Foldit_SaintJohn(NB) 1 pt. 0
  4. Avatar for Russian team 34. Russian team 1 pt. 0
  5. Avatar for Team India 35. Team India 1 pt. 0
  1. Avatar for tbhciro 321. tbhciro Lv 1 3 pts. 6,661
  2. Avatar for pavic_team 322. pavic_team Lv 1 3 pts. 6,653
  3. Avatar for Gde 323. Gde Lv 1 3 pts. 6,619
  4. Avatar for kourosh818181 324. kourosh818181 Lv 1 3 pts. 6,583
  5. Avatar for olicompsci 325. olicompsci Lv 1 3 pts. 6,575
  6. Avatar for IHeprooVV 326. IHeprooVV Lv 1 3 pts. 6,567
  7. Avatar for pbosnich 327. pbosnich Lv 1 3 pts. 6,553
  8. Avatar for Adhere95 328. Adhere95 Lv 1 3 pts. 6,518
  9. Avatar for ioloo 329. ioloo Lv 1 3 pts. 6,447
  10. Avatar for chocolate slayer 330. chocolate slayer Lv 1 3 pts. 6,435

Comments

Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.