Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups



  1. Avatar for cro0815 331. cro0815 Lv 1 3 pts. 6,423
  2. Avatar for User3.14 332. User3.14 Lv 1 3 pts. 6,404
  3. Avatar for agnszf 333. agnszf Lv 1 3 pts. 6,390
  4. Avatar for WilliamII 334. WilliamII Lv 1 3 pts. 6,310
  5. Avatar for GAVENvonAHYO 335. GAVENvonAHYO Lv 1 3 pts. 6,259
  6. Avatar for sparkbeetle 336. sparkbeetle Lv 1 3 pts. 6,239
  7. Avatar for Nikolaj_D_1987 337. Nikolaj_D_1987 Lv 1 3 pts. 6,235
  8. Avatar for jacob_n 338. jacob_n Lv 1 3 pts. 6,233
  9. Avatar for agyx 339. agyx Lv 1 3 pts. 6,210
  10. Avatar for badgoes 340. badgoes Lv 1 3 pts. 6,210

Comments


Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.