Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups



  1. Avatar for pauver04 471. pauver04 Lv 1 1 pt. 2,934
  2. Avatar for Wipf 472. Wipf Lv 1 1 pt. 2,927
  3. Avatar for Xenom Apperance 473. Xenom Apperance Lv 1 1 pt. 2,917
  4. Avatar for Hubertjuergens 474. Hubertjuergens Lv 1 1 pt. 2,915
  5. Avatar for Mikhop 475. Mikhop Lv 1 1 pt. 2,894
  6. Avatar for HMK 476. HMK Lv 1 1 pt. 2,884
  7. Avatar for sgnibar 477. sgnibar Lv 1 1 pt. 2,883
  8. Avatar for zo3xiaJonWeinberg 478. zo3xiaJonWeinberg Lv 1 1 pt. 2,867
  9. Avatar for xSnailu 479. xSnailu Lv 1 1 pt. 2,800
  10. Avatar for DH5alpha 480. DH5alpha Lv 1 1 pt. 2,799

Comments


Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.