Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups



  1. Avatar for pvc78 41. pvc78 Lv 1 73 pts. 9,861
  2. Avatar for rehhahn 42. rehhahn Lv 1 72 pts. 9,841
  3. Avatar for NinjaGreg 43. NinjaGreg Lv 1 71 pts. 9,828
  4. Avatar for Serca 44. Serca Lv 1 71 pts. 9,819
  5. Avatar for marsfan 45. marsfan Lv 1 70 pts. 9,803
  6. Avatar for OWM3 46. OWM3 Lv 1 70 pts. 9,786
  7. Avatar for HerobrinesArmy 47. HerobrinesArmy Lv 1 69 pts. 9,774
  8. Avatar for christioanchauvin 48. christioanchauvin Lv 1 68 pts. 9,763
  9. Avatar for Timo van der Laan 49. Timo van der Laan Lv 1 68 pts. 9,734
  10. Avatar for jeff101 50. jeff101 Lv 1 67 pts. 9,723

Comments


Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.