Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary

Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups

  1. Avatar for Star Fleet Academy Sciences Division 31. Star Fleet Academy Sciences Division 1 pt. 0
  2. Avatar for SHELL 32. SHELL 1 pt. 0
  3. Avatar for Foldit_SaintJohn(NB) 33. Foldit_SaintJohn(NB) 1 pt. 0
  4. Avatar for Russian team 34. Russian team 1 pt. 0
  5. Avatar for Team India 35. Team India 1 pt. 0
  1. Avatar for Darkwodka 511. Darkwodka Lv 1 1 pt. 1,619
  2. Avatar for dlepoire 512. dlepoire Lv 1 1 pt. 1,529
  3. Avatar for sgeldhof 513. sgeldhof Lv 1 1 pt. 1,430
  4. Avatar for Deleted player 514. Deleted player pts. 1,425
  5. Avatar for doctaven 515. doctaven Lv 1 1 pt. 1,384
  6. Avatar for York89 516. York89 Lv 1 1 pt. 1,258
  7. Avatar for snowleopard94 517. snowleopard94 Lv 1 1 pt. 1,157
  8. Avatar for Thibzer54 518. Thibzer54 Lv 1 1 pt. 1,064
  9. Avatar for Kihatsu 519. Kihatsu Lv 1 1 pt. 1,012
  10. Avatar for indien_du_nord 520. indien_du_nord Lv 1 1 pt. 630

Comments

Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.