Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since about 6 years ago

Intermediate Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups



  1. Avatar for BlinkyWatts 81. BlinkyWatts Lv 1 51 pts. 9,324
  2. Avatar for drjr 82. drjr Lv 1 51 pts. 9,320
  3. Avatar for krulon 83. krulon Lv 1 50 pts. 9,258
  4. Avatar for alwen 84. alwen Lv 1 50 pts. 9,247
  5. Avatar for w1seguy 85. w1seguy Lv 1 49 pts. 9,238
  6. Avatar for Ertonier 86. Ertonier Lv 1 49 pts. 9,228
  7. Avatar for SKSbell 87. SKSbell Lv 1 49 pts. 9,222
  8. Avatar for Glen B 88. Glen B Lv 1 48 pts. 9,220
  9. Avatar for WBarme1234 89. WBarme1234 Lv 1 48 pts. 9,203
  10. Avatar for j.wohlmann 90. j.wohlmann Lv 1 47 pts. 9,181

Comments


Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.