Placeholder image of a protein
Icon representing a puzzle

1820: Coronavirus ORF8 Prediction

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
April 01, 2020
Expires
Max points
100
Description

Fold this coronavirus protein! This protein is encoded in the viral genome of SARS-CoV-2, in a region called ORF8, but the protein's structure is still unknown. Evidence suggests this protein triggers a stress signal in the infected cell. If we knew how this protein folds, we might be able to figure out its exact function. The puzzle's starting structure shows SS predictions from PSIPRED, and hints which parts of the protein might fold into helices or sheets. Refold this protein to find high-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,813
  2. Avatar for Void Crushers 2. Void Crushers 87 pts. 10,614
  3. Avatar for Gargleblasters 3. Gargleblasters 74 pts. 10,502
  4. Avatar for Go Science 4. Go Science 64 pts. 10,460
  5. Avatar for Hold My Beer 5. Hold My Beer 54 pts. 10,456
  6. Avatar for Beta Folders 6. Beta Folders 46 pts. 10,284
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 38 pts. 10,196
  8. Avatar for Contenders 8. Contenders 32 pts. 10,151
  9. Avatar for Herobrine's Army 9. Herobrine's Army 27 pts. 9,774
  10. Avatar for Marvin's bunch 10. Marvin's bunch 22 pts. 9,717

  1. Avatar for TR77 171. TR77 Lv 1 21 pts. 8,309
  2. Avatar for Bigkam10 172. Bigkam10 Lv 1 21 pts. 8,304
  3. Avatar for paja22 173. paja22 Lv 1 21 pts. 8,294
  4. Avatar for Alistair69 174. Alistair69 Lv 1 21 pts. 8,284
  5. Avatar for Arne Heessels 175. Arne Heessels Lv 1 20 pts. 8,281
  6. Avatar for NeLikomSheet 176. NeLikomSheet Lv 1 20 pts. 8,271
  7. Avatar for wosser1 177. wosser1 Lv 1 20 pts. 8,268
  8. Avatar for Deleted player 178. Deleted player pts. 8,257
  9. Avatar for Dr_Fitch_mbs 179. Dr_Fitch_mbs Lv 1 20 pts. 8,255
  10. Avatar for Strawberry7 180. Strawberry7 Lv 1 19 pts. 8,241

Comments


Serca Lv 1

Some idea for design for that structures:

But it has a lot of exposed hydrophobic segments. So if it is not a membrane protein (but it could be because of the long helix), it doesn't hit the good score.

aofreelancer Lv 1

I do work at this puzzle two, i was able to fold it, but i have no biology science background was kind off thrown away by the complexity of it.