Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 8 pts. 9,630
  2. Avatar for Team China 12. Team China 6 pts. 9,605
  3. Avatar for Penny-Arcade 13. Penny-Arcade 4 pts. 9,545
  4. Avatar for BOINC@Poland 14. BOINC@Poland 3 pts. 9,531
  5. Avatar for CHNO Junkies 15. CHNO Junkies 2 pts. 9,491
  6. Avatar for Rechenkraft.net 16. Rechenkraft.net 2 pts. 9,470
  7. Avatar for HMT heritage 17. HMT heritage 1 pt. 9,466
  8. Avatar for Trinity Biology 18. Trinity Biology 1 pt. 9,397
  9. Avatar for NMHU Biol4230 Spr 20 19. NMHU Biol4230 Spr 20 1 pt. 9,220

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,905
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 99 pts. 9,880
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 97 pts. 9,836
  4. Avatar for Deleted player 4. Deleted player 96 pts. 9,835
  5. Avatar for mirp 5. mirp Lv 1 94 pts. 9,834
  6. Avatar for crpainter 6. crpainter Lv 1 93 pts. 9,833
  7. Avatar for Phyx 7. Phyx Lv 1 92 pts. 9,828
  8. Avatar for Xartos 8. Xartos Lv 1 90 pts. 9,824
  9. Avatar for Marvelz 9. Marvelz Lv 1 89 pts. 9,808
  10. Avatar for HerobrinesArmy 10. HerobrinesArmy Lv 1 87 pts. 9,795

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ