LociOiling Lv 1
It looks like this puzzle has the correct expiration time, the usual 1800 UTC, unlike the last few revisiting puzzles.
Closed since almost 6 years ago
Novice Novice Overall Overall Prediction PredictionThis is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
Sequence:
It looks like this puzzle has the correct expiration time, the usual 1800 UTC, unlike the last few revisiting puzzles.
LociOiling, they are different:
Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm
This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ
Yeah, it should be https://foldit.fandom.com/wiki/Revisiting_puzzle/111:_Mouse.
Rodent infestation!