Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020

  1. Avatar for edpalas 121. edpalas Lv 1 10 pts. 9,374
  2. Avatar for 181818 122. 181818 Lv 1 10 pts. 9,374
  3. Avatar for teftatene 123. teftatene Lv 1 10 pts. 9,368
  4. Avatar for tobu2 124. tobu2 Lv 1 10 pts. 9,363
  5. Avatar for dfonda 125. dfonda Lv 1 10 pts. 9,362
  6. Avatar for firejuggler 126. firejuggler Lv 1 9 pts. 9,360
  7. Avatar for KroZZ 127. KroZZ Lv 1 9 pts. 9,358
  8. Avatar for drjr 128. drjr Lv 1 9 pts. 9,358
  9. Avatar for ZiiONIC 129. ZiiONIC Lv 1 9 pts. 9,353
  10. Avatar for Merf 130. Merf Lv 1 8 pts. 9,348

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ