Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020
  1. Avatar for GBehrm 131. GBehrm Lv 1 8 pts. 9,333
  2. Avatar for frostschutz 132. frostschutz Lv 1 8 pts. 9,332
  3. Avatar for vybi 133. vybi Lv 1 8 pts. 9,329
  4. Avatar for paja22 134. paja22 Lv 1 8 pts. 9,325
  5. Avatar for anthion 135. anthion Lv 1 8 pts. 9,321
  6. Avatar for pangaena 136. pangaena Lv 1 7 pts. 9,319
  7. Avatar for fisherlr777 137. fisherlr777 Lv 1 7 pts. 9,313
  8. Avatar for rinze 138. rinze Lv 1 7 pts. 9,311
  9. Avatar for alcor29 139. alcor29 Lv 1 7 pts. 9,310
  10. Avatar for isaksson 140. isaksson Lv 1 7 pts. 9,310

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ