Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020

  1. Avatar for yaksari 151. yaksari Lv 1 5 pts. 9,276
  2. Avatar for Deleted player 152. Deleted player pts. 9,259
  3. Avatar for fanchquebec 153. fanchquebec Lv 1 5 pts. 9,257
  4. Avatar for JDBG 154. JDBG Lv 1 5 pts. 9,255
  5. Avatar for Mikisp 155. Mikisp Lv 1 5 pts. 9,254
  6. Avatar for Caraline_nelson 156. Caraline_nelson Lv 1 4 pts. 9,249
  7. Avatar for dannylee8 157. dannylee8 Lv 1 4 pts. 9,247
  8. Avatar for JasperD 158. JasperD Lv 1 4 pts. 9,247
  9. Avatar for PabloBP 159. PabloBP Lv 1 4 pts. 9,240
  10. Avatar for peggyemmy 160. peggyemmy Lv 1 4 pts. 9,239

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ