Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020

  1. Avatar for Feet1stEvolves 161. Feet1stEvolves Lv 1 4 pts. 9,238
  2. Avatar for kubek915 162. kubek915 Lv 1 4 pts. 9,236
  3. Avatar for deconstruct 163. deconstruct Lv 1 4 pts. 9,233
  4. Avatar for Artoria2e5 164. Artoria2e5 Lv 1 4 pts. 9,233
  5. Avatar for Mohoernchen 165. Mohoernchen Lv 1 3 pts. 9,232
  6. Avatar for foldit109ljsd 166. foldit109ljsd Lv 1 3 pts. 9,228
  7. Avatar for Serca 167. Serca Lv 1 3 pts. 9,223
  8. Avatar for Onkelzfan3 168. Onkelzfan3 Lv 1 3 pts. 9,223
  9. Avatar for ShadowTactics 169. ShadowTactics Lv 1 3 pts. 9,221
  10. Avatar for ahernandez25 170. ahernandez25 Lv 1 3 pts. 9,220

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ