Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020
  1. Avatar for Synarus 191. Synarus Lv 1 2 pts. 9,171
  2. Avatar for bcre8tvv 192. bcre8tvv Lv 1 2 pts. 9,163
  3. Avatar for JOSEAPH123 193. JOSEAPH123 Lv 1 2 pts. 9,162
  4. Avatar for tosimasa 194. tosimasa Lv 1 2 pts. 9,155
  5. Avatar for Manuel Garcia 195. Manuel Garcia Lv 1 2 pts. 9,152
  6. Avatar for abelkim0909 196. abelkim0909 Lv 1 2 pts. 9,151
  7. Avatar for rene1010 197. rene1010 Lv 1 1 pt. 9,144
  8. Avatar for Frosch2002 198. Frosch2002 Lv 1 1 pt. 9,141
  9. Avatar for navn 199. navn Lv 1 1 pt. 9,140
  10. Avatar for Neider98 200. Neider98 Lv 1 1 pt. 9,132

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ