Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020

  1. Avatar for J.I.M.P.O. 201. J.I.M.P.O. Lv 1 1 pt. 9,117
  2. Avatar for agujas 202. agujas Lv 1 1 pt. 9,111
  3. Avatar for Frutchy 203. Frutchy Lv 1 1 pt. 9,111
  4. Avatar for Mitcz 204. Mitcz Lv 1 1 pt. 9,108
  5. Avatar for xere88 205. xere88 Lv 1 1 pt. 9,107
  6. Avatar for Kraso_29 206. Kraso_29 Lv 1 1 pt. 9,100
  7. Avatar for tolgato 207. tolgato Lv 1 1 pt. 9,097
  8. Avatar for DaviMB 208. DaviMB Lv 1 1 pt. 9,096
  9. Avatar for Chandi95 209. Chandi95 Lv 1 1 pt. 9,091
  10. Avatar for LeoLeu 210. LeoLeu Lv 1 1 pt. 9,085

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ