Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020

  1. Avatar for Pyrodinium123 231. Pyrodinium123 Lv 1 1 pt. 8,984
  2. Avatar for YellowBearPL 232. YellowBearPL Lv 1 1 pt. 8,983
  3. Avatar for Tlaloc 233. Tlaloc Lv 1 1 pt. 8,982
  4. Avatar for Hogan1982 234. Hogan1982 Lv 1 1 pt. 8,981
  5. Avatar for MeighMeigh 235. MeighMeigh Lv 1 1 pt. 8,974
  6. Avatar for JustinRothganger 236. JustinRothganger Lv 1 1 pt. 8,970
  7. Avatar for ProfVince 237. ProfVince Lv 1 1 pt. 8,967
  8. Avatar for hajtogato 238. hajtogato Lv 1 1 pt. 8,965
  9. Avatar for AlkiP0Ps 239. AlkiP0Ps Lv 1 1 pt. 8,964
  10. Avatar for rlee287 240. rlee287 Lv 1 1 pt. 8,958

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ