Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020

  1. Avatar for testing0001 241. testing0001 Lv 1 1 pt. 8,956
  2. Avatar for Krzysztof_Z 242. Krzysztof_Z Lv 1 1 pt. 8,947
  3. Avatar for naesten 243. naesten Lv 1 1 pt. 8,939
  4. Avatar for froschi2 244. froschi2 Lv 1 1 pt. 8,935
  5. Avatar for KingFamily 245. KingFamily Lv 1 1 pt. 8,926
  6. Avatar for backterria 246. backterria Lv 1 1 pt. 8,918
  7. Avatar for Olga_A 247. Olga_A Lv 1 1 pt. 8,917
  8. Avatar for lou.exner 248. lou.exner Lv 1 1 pt. 8,904
  9. Avatar for CAN1958 249. CAN1958 Lv 1 1 pt. 8,894
  10. Avatar for marsfan 250. marsfan Lv 1 1 pt. 8,892

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ