Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020

  1. Avatar for baluooart 251. baluooart Lv 1 1 pt. 8,884
  2. Avatar for marbalex 252. marbalex Lv 1 1 pt. 8,856
  3. Avatar for jcepps 253. jcepps Lv 1 1 pt. 8,849
  4. Avatar for MarekeraM 254. MarekeraM Lv 1 1 pt. 8,848
  5. Avatar for jfpaquin02 255. jfpaquin02 Lv 1 1 pt. 8,841
  6. Avatar for kludbrook 256. kludbrook Lv 1 1 pt. 8,823
  7. Avatar for tbhciro 257. tbhciro Lv 1 1 pt. 8,816
  8. Avatar for Ash3rino 258. Ash3rino Lv 1 1 pt. 8,813
  9. Avatar for MerijnFolds 259. MerijnFolds Lv 1 1 pt. 8,808
  10. Avatar for zyz79 260. zyz79 Lv 1 1 pt. 8,805

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ