Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020
  1. Avatar for argyrw 271. argyrw Lv 1 1 pt. 8,572
  2. Avatar for Michael_is_folding 272. Michael_is_folding Lv 1 1 pt. 8,514
  3. Avatar for HMK 273. HMK Lv 1 1 pt. 8,496
  4. Avatar for weingran 274. weingran Lv 1 1 pt. 8,453
  5. Avatar for MAD_MAX_ 275. MAD_MAX_ Lv 1 1 pt. 8,436
  6. Avatar for monichen50 276. monichen50 Lv 1 1 pt. 8,361
  7. Avatar for NitaRe 277. NitaRe Lv 1 1 pt. 8,313
  8. Avatar for gerstmoon 278. gerstmoon Lv 1 1 pt. 8,282
  9. Avatar for ThomasFl 279. ThomasFl Lv 1 1 pt. 8,282
  10. Avatar for NeleB 280. NeleB Lv 1 1 pt. 8,248

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ