Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020
  1. Avatar for Blipperman 21. Blipperman Lv 1 73 pts. 9,718
  2. Avatar for robgee 22. robgee Lv 1 72 pts. 9,716
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 71 pts. 9,715
  4. Avatar for GuR0 24. GuR0 Lv 1 70 pts. 9,709
  5. Avatar for samchop 25. samchop Lv 1 69 pts. 9,707
  6. Avatar for j.wohlmann 26. j.wohlmann Lv 1 68 pts. 9,699
  7. Avatar for Galaxie 27. Galaxie Lv 1 66 pts. 9,698
  8. Avatar for Flagg65a 28. Flagg65a Lv 1 65 pts. 9,694
  9. Avatar for BootsMcGraw 29. BootsMcGraw Lv 1 64 pts. 9,693
  10. Avatar for jobo0502 30. jobo0502 Lv 1 63 pts. 9,691

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ