Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020
  1. Avatar for Picol_Santi 291. Picol_Santi Lv 1 1 pt. 7,950
  2. Avatar for Honor 292. Honor Lv 1 1 pt. 7,790
  3. Avatar for Paul Helmreich 293. Paul Helmreich Lv 1 1 pt. 7,265
  4. Avatar for Arti Lun Weishaar 294. Arti Lun Weishaar Lv 1 1 pt. 7,246
  5. Avatar for Dennis Tamariz 295. Dennis Tamariz Lv 1 1 pt. 7,213
  6. Avatar for Arkalys14 296. Arkalys14 Lv 1 1 pt. 7,151
  7. Avatar for ruben flores g 297. ruben flores g Lv 1 1 pt. 7,083
  8. Avatar for jotacebe 298. jotacebe Lv 1 1 pt. 7,031
  9. Avatar for Waschbaer.0 299. Waschbaer.0 Lv 1 1 pt. 7,015
  10. Avatar for DieJuFa 300. DieJuFa Lv 1 1 pt. 5,965

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ