Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020

  1. Avatar for n41722109 311. n41722109 Lv 1 1 pt. 5,020
  2. Avatar for puxatudo 312. puxatudo Lv 1 1 pt. 5,020
  3. Avatar for Alexander_Fleming 313. Alexander_Fleming Lv 1 1 pt. 5,020
  4. Avatar for sweetian 314. sweetian Lv 1 1 pt. 5,020
  5. Avatar for ichwilldiesennamen 315. ichwilldiesennamen Lv 1 1 pt. 5,020
  6. Avatar for Bletchley Park 316. Bletchley Park Lv 1 1 pt. 5,020
  7. Avatar for DerAndre1310 317. DerAndre1310 Lv 1 1 pt. 5,020
  8. Avatar for Tony_Jin 318. Tony_Jin Lv 1 1 pt. 5,020
  9. Avatar for loomis343 319. loomis343 Lv 1 1 pt. 5,020
  10. Avatar for precieux degoute 320. precieux degoute Lv 1 1 pt. 5,020

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ