Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020
  1. Avatar for guineapig 41. guineapig Lv 1 52 pts. 9,644
  2. Avatar for Evica 42. Evica Lv 1 51 pts. 9,643
  3. Avatar for NinjaGreg 43. NinjaGreg Lv 1 51 pts. 9,634
  4. Avatar for allie_heather47 44. allie_heather47 Lv 1 50 pts. 9,631
  5. Avatar for haabermaaster 45. haabermaaster Lv 1 49 pts. 9,630
  6. Avatar for silent gene 46. silent gene Lv 1 48 pts. 9,630
  7. Avatar for phi16 47. phi16 Lv 1 47 pts. 9,624
  8. Avatar for Vinara 48. Vinara Lv 1 46 pts. 9,621
  9. Avatar for SWR_DMaster 49. SWR_DMaster Lv 1 45 pts. 9,613
  10. Avatar for aznarog 50. aznarog Lv 1 45 pts. 9,613

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ