Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020
  1. Avatar for darixchel 61. darixchel Lv 1 37 pts. 9,552
  2. Avatar for TheGUmmer 62. TheGUmmer Lv 1 36 pts. 9,549
  3. Avatar for Anfinsen_slept_here 63. Anfinsen_slept_here Lv 1 35 pts. 9,546
  4. Avatar for LastAndroid 64. LastAndroid Lv 1 35 pts. 9,545
  5. Avatar for Pawel Tluscik 65. Pawel Tluscik Lv 1 34 pts. 9,544
  6. Avatar for ahkk 66. ahkk Lv 1 33 pts. 9,543
  7. Avatar for Dolichwier 67. Dolichwier Lv 1 33 pts. 9,540
  8. Avatar for kitek314_pl 68. kitek314_pl Lv 1 32 pts. 9,531
  9. Avatar for joaniegirl 69. joaniegirl Lv 1 31 pts. 9,529
  10. Avatar for Tygh 70. Tygh Lv 1 31 pts. 9,525

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ