Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020

  1. Avatar for nspc 71. nspc Lv 1 30 pts. 9,524
  2. Avatar for Jpilkington 72. Jpilkington Lv 1 30 pts. 9,522
  3. Avatar for alwen 73. alwen Lv 1 29 pts. 9,522
  4. Avatar for SKSbell 74. SKSbell Lv 1 29 pts. 9,518
  5. Avatar for meatexplosion 75. meatexplosion Lv 1 28 pts. 9,516
  6. Avatar for fpc 76. fpc Lv 1 27 pts. 9,510
  7. Avatar for harvardman 77. harvardman Lv 1 27 pts. 9,506
  8. Avatar for dahast.de 78. dahast.de Lv 1 26 pts. 9,504
  9. Avatar for heather-1 79. heather-1 Lv 1 26 pts. 9,503
  10. Avatar for WBarme1234 80. WBarme1234 Lv 1 25 pts. 9,501

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ