Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for ICSP HAP 2020 21. ICSP HAP 2020 1 pt. 9,151
  2. Avatar for Mojo Risin' 22. Mojo Risin' 1 pt. 8,982
  3. Avatar for SETI.Germany 23. SETI.Germany 1 pt. 8,496
  4. Avatar for Window Group 24. Window Group 1 pt. 5,020
  5. Avatar for BIOC 402 25. BIOC 402 1 pt. 5,020
  6. Avatar for Dr. B Orgo 2 26. Dr. B Orgo 2 1 pt. 5,020

  1. Avatar for pmlkjn 81. pmlkjn Lv 1 25 pts. 9,491
  2. Avatar for Glen B 82. Glen B Lv 1 24 pts. 9,487
  3. Avatar for badgoes 83. badgoes Lv 1 24 pts. 9,484
  4. Avatar for Czim 84. Czim Lv 1 23 pts. 9,482
  5. Avatar for abiogenesis 85. abiogenesis Lv 1 23 pts. 9,477
  6. Avatar for rabamino12358 86. rabamino12358 Lv 1 22 pts. 9,476
  7. Avatar for Crossed Sticks 87. Crossed Sticks Lv 1 22 pts. 9,474
  8. Avatar for wudoo 88. wudoo Lv 1 22 pts. 9,473
  9. Avatar for John McLeod 89. John McLeod Lv 1 21 pts. 9,472
  10. Avatar for versat82 90. versat82 Lv 1 21 pts. 9,470

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ