Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary

Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,905
  2. Avatar for Go Science 2. Go Science 82 pts. 9,880
  3. Avatar for Contenders 3. Contenders 66 pts. 9,822
  4. Avatar for Herobrine's Army 4. Herobrine's Army 53 pts. 9,795
  5. Avatar for Marvin's bunch 5. Marvin's bunch 42 pts. 9,768
  6. Avatar for Gargleblasters 6. Gargleblasters 33 pts. 9,762
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 26 pts. 9,758
  8. Avatar for Anthropic Dreams 8. Anthropic Dreams 20 pts. 9,741
  9. Avatar for Void Crushers 9. Void Crushers 15 pts. 9,683
  10. Avatar for Hold My Beer 10. Hold My Beer 11 pts. 9,674
  1. Avatar for Arne Heessels 111. Arne Heessels Lv 1 13 pts. 9,400
  2. Avatar for fabzs1 112. fabzs1 Lv 1 13 pts. 9,399
  3. Avatar for alyssa_d_V2.0 113. alyssa_d_V2.0 Lv 1 13 pts. 9,397
  4. Avatar for fabjacs 114. fabjacs Lv 1 12 pts. 9,394
  5. Avatar for goldfish80 115. goldfish80 Lv 1 12 pts. 9,393
  6. Avatar for GVA123 116. GVA123 Lv 1 12 pts. 9,391
  7. Avatar for kathy65 117. kathy65 Lv 1 11 pts. 9,388
  8. Avatar for Argantyr 118. Argantyr Lv 1 11 pts. 9,385
  9. Avatar for Hum 119. Hum Lv 1 11 pts. 9,378
  10. Avatar for RiaSkies 120. RiaSkies Lv 1 11 pts. 9,375

Comments

Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ