Placeholder image of a protein
Icon representing a puzzle

1822: Revisiting Puzzle 111: Mouse

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 07, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 9,905
  2. Avatar for Go Science 2. Go Science 82 pts. 9,880
  3. Avatar for Contenders 3. Contenders 66 pts. 9,822
  4. Avatar for Herobrine's Army 4. Herobrine's Army 53 pts. 9,795
  5. Avatar for Marvin's bunch 5. Marvin's bunch 42 pts. 9,768
  6. Avatar for Gargleblasters 6. Gargleblasters 33 pts. 9,762
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 26 pts. 9,758
  8. Avatar for Anthropic Dreams 8. Anthropic Dreams 20 pts. 9,741
  9. Avatar for Void Crushers 9. Void Crushers 15 pts. 9,683
  10. Avatar for Hold My Beer 10. Hold My Beer 11 pts. 9,674

  1. Avatar for donuts554 171. donuts554 Lv 1 3 pts. 9,219
  2. Avatar for yippee 172. yippee Lv 1 3 pts. 9,216
  3. Avatar for w1seguy 173. w1seguy Lv 1 3 pts. 9,215
  4. Avatar for Owens24 174. Owens24 Lv 1 3 pts. 9,215
  5. Avatar for foldthestuffman 175. foldthestuffman Lv 1 3 pts. 9,215
  6. Avatar for lraguette 176. lraguette Lv 1 3 pts. 9,215
  7. Avatar for JAucitel 177. JAucitel Lv 1 3 pts. 9,209
  8. Avatar for spdenne 178. spdenne Lv 1 2 pts. 9,208
  9. Avatar for cyberman500 179. cyberman500 Lv 1 2 pts. 9,207
  10. Avatar for jojo2525 180. jojo2525 Lv 1 2 pts. 9,205

Comments


Serca Lv 1

LociOiling, they are different:

Wiki:
asnydcclsyiqtplpsraivgftrqmadeacdinaiifhtkkrksvcadpkqnwvkravnllslrvkkm

This one:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ