Placeholder image of a protein
Icon representing a puzzle

1823: Coronavirus ORF8 Prediction Round 2

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 09, 2020
Expires
Max points
100
Description

This is a follow-up to Puzzle 1820, but this time we are providing you with a starting model. Players may load in previous work from Puzzle 1820. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!

Top groups


  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 18 pts. 10,315
  2. Avatar for L'Alliance Francophone 12. L'Alliance Francophone 15 pts. 10,193
  3. Avatar for BOINC@Poland 13. BOINC@Poland 12 pts. 9,706
  4. Avatar for Penny-Arcade 14. Penny-Arcade 9 pts. 9,470
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 8 pts. 9,313
  6. Avatar for Mojo Risin' 16. Mojo Risin' 6 pts. 9,311
  7. Avatar for Deleted group 17. Deleted group pts. 9,303
  8. Avatar for Deleted group 18. Deleted group pts. 8,972
  9. Avatar for Dr. B Orgo 2 19. Dr. B Orgo 2 3 pts. 8,942
  10. Avatar for HMT heritage 20. HMT heritage 2 pts. 8,938

  1. Avatar for Carresu 511. Carresu Lv 1 1 pt. 6,593
  2. Avatar for tainguyen 512. tainguyen Lv 1 1 pt. 6,593
  3. Avatar for weronika.malysiak 513. weronika.malysiak Lv 1 1 pt. 6,593
  4. Avatar for jeffone 514. jeffone Lv 1 1 pt. 6,593
  5. Avatar for rout 515. rout Lv 1 1 pt. 6,593
  6. Avatar for CHM2211CABHFsp2020 516. CHM2211CABHFsp2020 Lv 1 1 pt. 6,593
  7. Avatar for klavier05 517. klavier05 Lv 1 1 pt. 6,593
  8. Avatar for DerAndre1310 518. DerAndre1310 Lv 1 1 pt. 6,593
  9. Avatar for Waukeeblobel 519. Waukeeblobel Lv 1 1 pt. 6,593
  10. Avatar for MaRoj2020 520. MaRoj2020 Lv 1 1 pt. 6,593

Comments


Skippysk8s Lv 1

mkflvflgiittvaafhqecslqsctqhqpyvvddpcpihfyskwyirvgarksaplielcvdeagskspiqyidignytvsclpftincqepklgslvvrcsfyedfleyhdvrvvldfi

if this helps those of you who can do overlays well

Skippysk8s Lv 1

LHHHHHHHHHHHHHHHHLLLLHHHHHHLLLLLLLLLHHHLLLLLLEEEEEEELLEEEEEEELLLLLLEEEELLEELLLLEELLLLLLLLLLLLLLLEEEEEEEEEELLLEEEEEEEEEELL

grogar7 Lv 1

It would be a good idea to let folks know about this option from the start. I will post in chat and Discord.

grogar7 Lv 1

Why would the development team allow players to load builds from puzzle 1820 into this puzzle? Are you looking for refinements to those prior builds, or do you really want us to start with the structure you have presented?

Wouldn't it tend to stifle the competition if I load my high scoring build from 1820?

Thanks,
grogar7

bnmoore Lv 1

Sorry if this is a naive question; is it known whether the first 15 AA are a signal peptide that is cleaved off in the actual protein?

beta_helix Staff Lv 1

I added this info to the puzzle description.

This starting topology is just a suggestion, as we have no idea how correct/incorrect it is.

However, we can imagine players modifying their previous predictions based on this model… or even creating hybrids between the two (which is why I want to fix the "load as guide" issue).