Placeholder image of a protein
Icon representing a puzzle

1823: Coronavirus ORF8 Prediction Round 2

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 09, 2020
Expires
Max points
100
Description

This is a follow-up to Puzzle 1820, but this time we are providing you with a starting model. Players may load in previous work from Puzzle 1820. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!

Top groups


  1. Avatar for CHNO Junkies 21. CHNO Junkies 2 pts. 8,711
  2. Avatar for Rechenkraft.net 22. Rechenkraft.net 1 pt. 8,653
  3. Avatar for Team China 23. Team China 1 pt. 8,631
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 8,510
  5. Avatar for SETI.Germany 25. SETI.Germany 1 pt. 8,437
  6. Avatar for Minions of TWIS 26. Minions of TWIS 1 pt. 8,003
  7. Avatar for Villanova ChE 27. Villanova ChE 1 pt. 7,931
  8. Avatar for Russian team 29. Russian team 1 pt. 7,659
  9. Avatar for ICSP HAP 2020 30. ICSP HAP 2020 1 pt. 7,616

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,825
  2. Avatar for NinjaGreg 2. NinjaGreg Lv 1 92 pts. 10,770
  3. Avatar for puxatudo 3. puxatudo Lv 1 83 pts. 10,769
  4. Avatar for w1seguy 4. w1seguy Lv 1 76 pts. 10,769
  5. Avatar for Dhalion 5. Dhalion Lv 1 69 pts. 10,769
  6. Avatar for Czim 6. Czim Lv 1 62 pts. 10,766
  7. Avatar for robgee 7. robgee Lv 1 56 pts. 10,765
  8. Avatar for pente_player 8. pente_player Lv 1 50 pts. 10,765
  9. Avatar for silent gene 9. silent gene Lv 1 45 pts. 10,764
  10. Avatar for mirp 10. mirp Lv 1 41 pts. 10,762

Comments


Skippysk8s Lv 1

mkflvflgiittvaafhqecslqsctqhqpyvvddpcpihfyskwyirvgarksaplielcvdeagskspiqyidignytvsclpftincqepklgslvvrcsfyedfleyhdvrvvldfi

if this helps those of you who can do overlays well

Skippysk8s Lv 1

LHHHHHHHHHHHHHHHHLLLLHHHHHHLLLLLLLLLHHHLLLLLLEEEEEEELLEEEEEEELLLLLLEEEELLEELLLLEELLLLLLLLLLLLLLLEEEEEEEEEELLLEEEEEEEEEELL

grogar7 Lv 1

It would be a good idea to let folks know about this option from the start. I will post in chat and Discord.

grogar7 Lv 1

Why would the development team allow players to load builds from puzzle 1820 into this puzzle? Are you looking for refinements to those prior builds, or do you really want us to start with the structure you have presented?

Wouldn't it tend to stifle the competition if I load my high scoring build from 1820?

Thanks,
grogar7

bnmoore Lv 1

Sorry if this is a naive question; is it known whether the first 15 AA are a signal peptide that is cleaved off in the actual protein?

beta_helix Staff Lv 1

I added this info to the puzzle description.

This starting topology is just a suggestion, as we have no idea how correct/incorrect it is.

However, we can imagine players modifying their previous predictions based on this model… or even creating hybrids between the two (which is why I want to fix the "load as guide" issue).