Skippysk8s Lv 1
mkflvflgiittvaafhqecslqsctqhqpyvvddpcpihfyskwyirvgarksaplielcvdeagskspiqyidignytvsclpftincqepklgslvvrcsfyedfleyhdvrvvldfi
if this helps those of you who can do overlays well
Closed since almost 6 years ago
Novice Novice Overall Overall Prediction PredictionThis is a follow-up to Puzzle 1820, but this time we are providing you with a starting model. Players may load in previous work from Puzzle 1820. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!
mkflvflgiittvaafhqecslqsctqhqpyvvddpcpihfyskwyirvgarksaplielcvdeagskspiqyidignytvsclpftincqepklgslvvrcsfyedfleyhdvrvvldfi
if this helps those of you who can do overlays well
LHHHHHHHHHHHHHHHHLLLLHHHHHHLLLLLLLLLHHHLLLLLLEEEEEEELLEEEEEEELLLLLLEEEELLEELLLLEELLLLLLLLLLLLLLLEEEEEEEEEELLLEEEEEEEEEELL
It would be a good idea to let folks know about this option from the start. I will post in chat and Discord.
You can load a solution from 1820, but you can't use it for "load as guide".
Why would the development team allow players to load builds from puzzle 1820 into this puzzle? Are you looking for refinements to those prior builds, or do you really want us to start with the structure you have presented?
Wouldn't it tend to stifle the competition if I load my high scoring build from 1820?
Thanks,
grogar7
Sorry if this is a naive question; is it known whether the first 15 AA are a signal peptide that is cleaved off in the actual protein?
The starting model provided looks just like the one PSPRED indicated, I was wondering why it looked so similar to my last attempt… http://bioinf.cs.ucl.ac.uk/psipred/&uuid=3c238016-7823-11ea-b4c4-00163e100d53
Since this puzzle has the same sequence as in Puzzle 1820:
https://fold.it/portal/node/2009337
should we still expect none of its 7 cysteines to form
disulfide bonds? Should we also expect all 7 of its
cysteines to be on the protein exterior?
I'll look into why "load as guide" isn't working.
I added this info to the puzzle description.
This starting topology is just a suggestion, as we have no idea how correct/incorrect it is.
However, we can imagine players modifying their previous predictions based on this model… or even creating hybrids between the two (which is why I want to fix the "load as guide" issue).