Placeholder image of a protein
Icon representing a puzzle

1823: Coronavirus ORF8 Prediction Round 2

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2020
Expires
Max points
100
Description

This is a follow-up to Puzzle 1820, but this time we are providing you with a starting model. Players may load in previous work from Puzzle 1820. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,825
  2. Avatar for Go Science 2. Go Science 87 pts. 10,770
  3. Avatar for Beta Folders 3. Beta Folders 74 pts. 10,675
  4. Avatar for Gargleblasters 4. Gargleblasters 64 pts. 10,640
  5. Avatar for Void Crushers 5. Void Crushers 54 pts. 10,615
  6. Avatar for Marvin's bunch 6. Marvin's bunch 46 pts. 10,584
  7. Avatar for Team India 7. Team India 38 pts. 10,502
  8. Avatar for Contenders 8. Contenders 32 pts. 10,486
  9. Avatar for Hold My Beer 9. Hold My Beer 27 pts. 10,456
  10. Avatar for Herobrine's Army 10. Herobrine's Army 22 pts. 10,335

  1. Avatar for silent gene 21. silent gene Lv 1 84 pts. 10,351
  2. Avatar for steveB 22. steveB Lv 1 83 pts. 10,349
  3. Avatar for HerobrinesArmy 23. HerobrinesArmy Lv 1 83 pts. 10,335
  4. Avatar for Satina 24. Satina Lv 1 82 pts. 10,315
  5. Avatar for g_b 25. g_b Lv 1 81 pts. 10,312
  6. Avatar for Skippysk8s 26. Skippysk8s Lv 1 80 pts. 10,302
  7. Avatar for Bletchley Park 27. Bletchley Park Lv 1 80 pts. 10,291
  8. Avatar for TheGUmmer 28. TheGUmmer Lv 1 79 pts. 10,289
  9. Avatar for robgee 29. robgee Lv 1 78 pts. 10,283
  10. Avatar for Migi 30. Migi Lv 1 77 pts. 10,271

Comments


Skippysk8s Lv 1

mkflvflgiittvaafhqecslqsctqhqpyvvddpcpihfyskwyirvgarksaplielcvdeagskspiqyidignytvsclpftincqepklgslvvrcsfyedfleyhdvrvvldfi

if this helps those of you who can do overlays well

Skippysk8s Lv 1

LHHHHHHHHHHHHHHHHLLLLHHHHHHLLLLLLLLLHHHLLLLLLEEEEEEELLEEEEEEELLLLLLEEEELLEELLLLEELLLLLLLLLLLLLLLEEEEEEEEEELLLEEEEEEEEEELL

grogar7 Lv 1

It would be a good idea to let folks know about this option from the start. I will post in chat and Discord.

grogar7 Lv 1

Why would the development team allow players to load builds from puzzle 1820 into this puzzle? Are you looking for refinements to those prior builds, or do you really want us to start with the structure you have presented?

Wouldn't it tend to stifle the competition if I load my high scoring build from 1820?

Thanks,
grogar7

bnmoore Lv 1

Sorry if this is a naive question; is it known whether the first 15 AA are a signal peptide that is cleaved off in the actual protein?

beta_helix Staff Lv 1

I added this info to the puzzle description.

This starting topology is just a suggestion, as we have no idea how correct/incorrect it is.

However, we can imagine players modifying their previous predictions based on this model… or even creating hybrids between the two (which is why I want to fix the "load as guide" issue).