Placeholder image of a protein
Icon representing a puzzle

1826: Coronavirus Trimmed ORF8 Prediction

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 16, 2020
Expires
Max points
100
Description

This is a follow-up to Puzzle 1823, but players noticed that the first 15 amino acids are highly predicted to be a signal peptide, so we have trimmed those residues from this puzzle. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this different starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 14 pts. 9,325
  2. Avatar for Marvin's bunch 12. Marvin's bunch 11 pts. 8,993
  3. Avatar for Dr. B Orgo 2 13. Dr. B Orgo 2 8 pts. 8,508
  4. Avatar for BOINC@Poland 14. BOINC@Poland 6 pts. 8,262
  5. Avatar for Mojo Risin' 15. Mojo Risin' 5 pts. 7,404
  6. Avatar for Czech National Team 16. Czech National Team 4 pts. 7,352
  7. Avatar for Team China 17. Team China 3 pts. 7,255
  8. Avatar for DSN @ Home 18. DSN @ Home 2 pts. 6,754
  9. Avatar for Rechenkraft.net 19. Rechenkraft.net 2 pts. 5,945
  10. Avatar for Fox Folds 20. Fox Folds 1 pt. 5,543

  1. Avatar for w1seguy 51. w1seguy Lv 1 64 pts. 9,502
  2. Avatar for robgee 52. robgee Lv 1 64 pts. 9,494
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 63 pts. 9,473
  4. Avatar for Satina 54. Satina Lv 1 63 pts. 9,473
  5. Avatar for Anfinsen_slept_here 55. Anfinsen_slept_here Lv 1 62 pts. 9,466
  6. Avatar for inhtih 56. inhtih Lv 1 62 pts. 9,465
  7. Avatar for EmmaLives 57. EmmaLives Lv 1 61 pts. 9,447
  8. Avatar for yaksari 58. yaksari Lv 1 60 pts. 9,424
  9. Avatar for bertro 59. bertro Lv 1 60 pts. 9,406
  10. Avatar for bnmoore 60. bnmoore Lv 1 59 pts. 9,384

Comments


Formula350 Lv 1

That was my exact thinking. I just had never personally encountered one where (seemingly) arbitrary spaces get replaced like that! lol
I've seen apostrophes, line-breaks, special characters (like accented or other language), but can't say I've seen spaces! :D

I'm admittedly curious what DID end up to be the cause, now that it's fixed! heh

LociOiling Lv 1

Client shows I've soared to #1 on 1826, but website shows Steven Pletsch is still in command.

Something is borken.

beta_helix Staff Lv 1

Unfortunately, we really don't have any additional information about this protein… so we can't be confident one way or another.

I would suggest trying different topologies with and without disulfide bonds.

agcohn821 Staff Lv 1

Hi there! If you're interested in learning more and getting higher scores, I would suggest joining our discord channel to chat with other players and maybe get some helpful pointers!