Placeholder image of a protein
Icon representing a puzzle

1826: Coronavirus Trimmed ORF8 Prediction

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 16, 2020
Expires
Max points
100
Description

This is a follow-up to Puzzle 1823, but players noticed that the first 15 amino acids are highly predicted to be a signal peptide, so we have trimmed those residues from this puzzle. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this different starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 14 pts. 9,325
  2. Avatar for Marvin's bunch 12. Marvin's bunch 11 pts. 8,993
  3. Avatar for Dr. B Orgo 2 13. Dr. B Orgo 2 8 pts. 8,508
  4. Avatar for BOINC@Poland 14. BOINC@Poland 6 pts. 8,262
  5. Avatar for Mojo Risin' 15. Mojo Risin' 5 pts. 7,404
  6. Avatar for Czech National Team 16. Czech National Team 4 pts. 7,352
  7. Avatar for Team China 17. Team China 3 pts. 7,255
  8. Avatar for DSN @ Home 18. DSN @ Home 2 pts. 6,754
  9. Avatar for Rechenkraft.net 19. Rechenkraft.net 2 pts. 5,945
  10. Avatar for Fox Folds 20. Fox Folds 1 pt. 5,543

  1. Avatar for tirhandilla 391. tirhandilla Lv 1 1 pt. 4,430
  2. Avatar for CHM1045C945cg2020 393. CHM1045C945cg2020 Lv 1 1 pt. 4,366
  3. Avatar for WorldLand 394. WorldLand Lv 1 1 pt. 4,337
  4. Avatar for komrad7 395. komrad7 Lv 1 1 pt. 4,329
  5. Avatar for FullXD 396. FullXD Lv 1 1 pt. 4,306
  6. Avatar for Lokkos 397. Lokkos Lv 1 1 pt. 4,274
  7. Avatar for Bath Mat 398. Bath Mat Lv 1 1 pt. 4,227
  8. Avatar for mimovilla 399. mimovilla Lv 1 1 pt. 4,219
  9. Avatar for luminems 400. luminems Lv 1 1 pt. 4,213

Comments


Xartos Lv 1

I have some issue with the scoreboard. Cant see the scores from other players. Only getting a text saying 'Getting player list…'

Formula350 Lv 1

Was that it might have something to do with however the puzzle was made. My thinking is that whatever caused the puzzle's description to get goofed up with ?s being randomly swapped in for spaces, might also have caused a hidden issue in the puzzle's name, too.
If that's the case, perhaps the server isn't able to properly recognize the title and can't generate the scoreboard?

MaciekB Lv 1

It could be encoding error. Some encodings has different character codes for space or new line (it would explain those ?s) and different characters too.