Placeholder image of a protein
Icon representing a puzzle

1826: Coronavirus Trimmed ORF8 Prediction

Closed since about 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 16, 2020
Expires
Max points
100
Description

This is a follow-up to Puzzle 1823, but players noticed that the first 15 amino acids are highly predicted to be a signal peptide, so we have trimmed those residues from this puzzle. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this different starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 14 pts. 9,325
  2. Avatar for Marvin's bunch 12. Marvin's bunch 11 pts. 8,993
  3. Avatar for Dr. B Orgo 2 13. Dr. B Orgo 2 8 pts. 8,508
  4. Avatar for BOINC@Poland 14. BOINC@Poland 6 pts. 8,262
  5. Avatar for Mojo Risin' 15. Mojo Risin' 5 pts. 7,404
  6. Avatar for Czech National Team 16. Czech National Team 4 pts. 7,352
  7. Avatar for Team China 17. Team China 3 pts. 7,255
  8. Avatar for DSN @ Home 18. DSN @ Home 2 pts. 6,754
  9. Avatar for Rechenkraft.net 19. Rechenkraft.net 2 pts. 5,945
  10. Avatar for Fox Folds 20. Fox Folds 1 pt. 5,543

  1. Avatar for Honor 421. Honor Lv 1 1 pt. 3,331
  2. Avatar for nguyenania 422. nguyenania Lv 1 1 pt. 3,290
  3. Avatar for PingHu 423. PingHu Lv 1 1 pt. 3,289
  4. Avatar for eevlva 424. eevlva Lv 1 1 pt. 3,194
  5. Avatar for Sergey Alekseychuk 425. Sergey Alekseychuk Lv 1 1 pt. 3,157
  6. Avatar for Obi-Mo Kenobi 426. Obi-Mo Kenobi Lv 1 1 pt. 3,107
  7. Avatar for ruben_02_12 427. ruben_02_12 Lv 1 1 pt. 3,094
  8. Avatar for Badflooder 429. Badflooder Lv 1 1 pt. 2,650
  9. Avatar for clinder 430. clinder Lv 1 1 pt. 2,603

Comments


Xartos Lv 1

I have some issue with the scoreboard. Cant see the scores from other players. Only getting a text saying 'Getting player list…'

Formula350 Lv 1

Was that it might have something to do with however the puzzle was made. My thinking is that whatever caused the puzzle's description to get goofed up with ?s being randomly swapped in for spaces, might also have caused a hidden issue in the puzzle's name, too.
If that's the case, perhaps the server isn't able to properly recognize the title and can't generate the scoreboard?

MaciekB Lv 1

It could be encoding error. Some encodings has different character codes for space or new line (it would explain those ?s) and different characters too.