Placeholder image of a protein
Icon representing a puzzle

1826: Coronavirus Trimmed ORF8 Prediction

Closed since almost 6 years ago

Novice Overall Prediction

Summary


Created
April 16, 2020
Expires
Max points
100
Description

This is a follow-up to Puzzle 1823, but players noticed that the first 15 amino acids are highly predicted to be a signal peptide, so we have trimmed those residues from this puzzle. This protein is encoded in the viral genome of SARS-CoV-2, but the protein's structure is still unknown. If we knew how this protein folds, we might be able to figure out its exact function. Refold this different starting model to find higher-scoring solutions, which will tell us how this protein is most likely to fold!



Sequence:


FHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI

Top groups



  1. Avatar for rabamino12358 181. rabamino12358 Lv 1 16 pts. 7,426
  2. Avatar for GVA123 182. GVA123 Lv 1 16 pts. 7,422
  3. Avatar for Biochemica 183. Biochemica Lv 1 16 pts. 7,410
  4. Avatar for Tlaloc 184. Tlaloc Lv 1 16 pts. 7,404
  5. Avatar for cobaltteal 185. cobaltteal Lv 1 16 pts. 7,396
  6. Avatar for zhq971216 186. zhq971216 Lv 1 15 pts. 7,376
  7. Avatar for froschi2 187. froschi2 Lv 1 15 pts. 7,373
  8. Avatar for ProfVince 188. ProfVince Lv 1 15 pts. 7,363
  9. Avatar for xapeiron 189. xapeiron Lv 1 15 pts. 7,352
  10. Avatar for kastberg 190. kastberg Lv 1 15 pts. 7,345

Comments


Formula350 Lv 1

That was my exact thinking. I just had never personally encountered one where (seemingly) arbitrary spaces get replaced like that! lol
I've seen apostrophes, line-breaks, special characters (like accented or other language), but can't say I've seen spaces! :D

I'm admittedly curious what DID end up to be the cause, now that it's fixed! heh

LociOiling Lv 1

Client shows I've soared to #1 on 1826, but website shows Steven Pletsch is still in command.

Something is borken.

beta_helix Staff Lv 1

Unfortunately, we really don't have any additional information about this protein… so we can't be confident one way or another.

I would suggest trying different topologies with and without disulfide bonds.

agcohn821 Staff Lv 1

Hi there! If you're interested in learning more and getting higher scores, I would suggest joining our discord channel to chat with other players and maybe get some helpful pointers!